Pay in 4 interest-free payments of $150.50 Learn more
Ships within 48 hours · Estimated delivery Aug 3 - Aug 8
Complement deficiencies or other defects in the complement system can easily be screened by running an assay for each pathway in parallel or separately
CAS # 77521-29-0
Model(s): Agilent 1100
0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) (Gene ID: 100033949)
PEEK Fingertight fittings are rated to 350 bar (5000 psi) and can be used in virtually any type of 10-32 thread HPLC fitting detail on the market
sCD14, Human, ELISA kit, 1 x 96 det. 8396-Epigenetic Antibodies Complement deficiencies or other defectsCD14, the 55 kDa glycoprotein known to function as a receptor for LPS, is expressed mainly on the surface of monocytes macrophages, and PMN, the cells responsible for scavenging of LPS and bacteria. Although monocytes and PMN are the main CD14 expressing cells few reports have described CD14 expression on B cells, mesangial cells and basophils. The plasma protein LBP plays an important role in the LPS CD14 mediated cell activation. In addition to the
US$ 57.60
US$ 461.38
US$ 14.29
US$ 100.00
